Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/FR47-DUF1778 |
| Location | 35976..36771 | Replicon | plasmid pMB7868_2 |
| Accession | NZ_CP103584 | ||
| Organism | Klebsiella pneumoniae strain 1498 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | M5S97_RS27090 | Protein ID | WP_064383561.1 |
| Coordinates | 36253..36771 (+) | Length | 173 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | - |
| Locus tag | M5S97_RS27085 | Protein ID | WP_064383558.1 |
| Coordinates | 35976..36248 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S97_RS27060 (M5S97_27060) | 31618..32979 | - | 1362 | WP_064383547.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M5S97_RS27065 (M5S97_27065) | 33024..33764 | - | 741 | WP_064383550.1 | hypothetical protein | - |
| M5S97_RS27070 (M5S97_27070) | 33944..34420 | + | 477 | WP_130573867.1 | hypothetical protein | - |
| M5S97_RS27075 (M5S97_27075) | 34622..34996 | - | 375 | WP_064383554.1 | hypothetical protein | - |
| M5S97_RS27080 (M5S97_27080) | 35002..35667 | - | 666 | WP_064383556.1 | AAA family ATPase | - |
| M5S97_RS27085 (M5S97_27085) | 35976..36248 | + | 273 | WP_064383558.1 | DUF1778 domain-containing protein | Antitoxin |
| M5S97_RS27090 (M5S97_27090) | 36253..36771 | + | 519 | WP_064383561.1 | GNAT family N-acetyltransferase | Toxin |
| M5S97_RS27095 (M5S97_27095) | 36903..37112 | + | 210 | WP_064383564.1 | hypothetical protein | - |
| M5S97_RS27100 (M5S97_27100) | 37335..37586 | - | 252 | WP_064383566.1 | hypothetical protein | - |
| M5S97_RS27105 (M5S97_27105) | 37583..38275 | - | 693 | WP_064383568.1 | hypothetical protein | - |
| M5S97_RS27110 (M5S97_27110) | 38286..38600 | - | 315 | WP_009484919.1 | hypothetical protein | - |
| M5S97_RS27115 (M5S97_27115) | 38683..40224 | - | 1542 | WP_130573866.1 | tail fiber domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..111561 | 111561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19297.07 Da Isoelectric Point: 6.4627
>T255676 WP_064383561.1 NZ_CP103584:36253-36771 [Klebsiella pneumoniae]
VNTYDIEPIQKDFPYDISSFDCGNEALNLFLSEHLQRQDEKQILRGYVYLEYGSGLPKVLGFFTLAGGSFERSRFPSKSQ
QKKIPYTNTPCIILGRLAVDKTVQRQGIGEMLVVEAAKVVLQAANAIGLHGMFVDAKNESACKFYENLGFTRLIGDNENL
FFYPTSKIAQLP
VNTYDIEPIQKDFPYDISSFDCGNEALNLFLSEHLQRQDEKQILRGYVYLEYGSGLPKVLGFFTLAGGSFERSRFPSKSQ
QKKIPYTNTPCIILGRLAVDKTVQRQGIGEMLVVEAAKVVLQAANAIGLHGMFVDAKNESACKFYENLGFTRLIGDNENL
FFYPTSKIAQLP
Download Length: 519 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|