Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4737460..4737976 | Replicon | chromosome |
Accession | NZ_CP103582 | ||
Organism | Klebsiella pneumoniae strain 1498 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A085DK79 |
Locus tag | M5S97_RS23200 | Protein ID | WP_009309309.1 |
Coordinates | 4737460..4737744 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M5S97_RS23205 | Protein ID | WP_002886901.1 |
Coordinates | 4737734..4737976 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S97_RS23175 (M5S97_23175) | 4732936..4733199 | - | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
M5S97_RS23180 (M5S97_23180) | 4733329..4733502 | + | 174 | WP_032409292.1 | hypothetical protein | - |
M5S97_RS23185 (M5S97_23185) | 4733505..4734248 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5S97_RS23190 (M5S97_23190) | 4734605..4736743 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5S97_RS23195 (M5S97_23195) | 4736992..4737456 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5S97_RS23200 (M5S97_23200) | 4737460..4737744 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S97_RS23205 (M5S97_23205) | 4737734..4737976 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5S97_RS23210 (M5S97_23210) | 4738054..4739964 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M5S97_RS23215 (M5S97_23215) | 4739987..4741141 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M5S97_RS23220 (M5S97_23220) | 4741208..4741948 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T255672 WP_009309309.1 NZ_CP103582:c4737744-4737460 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085DK79 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |