Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4026838..4027457 Replicon chromosome
Accession NZ_CP103582
Organism Klebsiella pneumoniae strain 1498

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5S97_RS19800 Protein ID WP_002892050.1
Coordinates 4027239..4027457 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5S97_RS19795 Protein ID WP_002892066.1
Coordinates 4026838..4027212 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S97_RS19785 (M5S97_19785) 4021990..4023183 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5S97_RS19790 (M5S97_19790) 4023206..4026352 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5S97_RS19795 (M5S97_19795) 4026838..4027212 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5S97_RS19800 (M5S97_19800) 4027239..4027457 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5S97_RS19805 (M5S97_19805) 4027616..4028182 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5S97_RS19810 (M5S97_19810) 4028154..4028294 - 141 WP_004147370.1 hypothetical protein -
M5S97_RS19815 (M5S97_19815) 4028315..4028785 + 471 WP_002892026.1 YlaC family protein -
M5S97_RS19820 (M5S97_19820) 4028760..4030211 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M5S97_RS19825 (M5S97_19825) 4030312..4031010 + 699 WP_004177238.1 GNAT family protein -
M5S97_RS19830 (M5S97_19830) 4031007..4031147 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5S97_RS19835 (M5S97_19835) 4031147..4031410 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255670 WP_002892050.1 NZ_CP103582:4027239-4027457 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255670 WP_002892066.1 NZ_CP103582:4026838-4027212 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References