Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 3156340..3156971 Replicon chromosome
Accession NZ_CP103582
Organism Klebsiella pneumoniae strain 1498

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag M5S97_RS15595 Protein ID WP_012542177.1
Coordinates 3156795..3156971 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A3Q9U6R4
Locus tag M5S97_RS15590 Protein ID WP_017898984.1
Coordinates 3156340..3156747 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S97_RS15560 (M5S97_15560) 3152105..3152593 - 489 WP_023342892.1 DUF1441 family protein -
M5S97_RS15565 (M5S97_15565) 3152825..3153244 - 420 WP_032422409.1 hypothetical protein -
M5S97_RS15570 (M5S97_15570) 3153244..3153552 - 309 WP_020315022.1 hypothetical protein -
M5S97_RS15575 (M5S97_15575) 3154533..3154883 - 351 WP_072122266.1 hypothetical protein -
M5S97_RS15580 (M5S97_15580) 3154880..3155377 - 498 WP_032439908.1 lysozyme -
M5S97_RS15585 (M5S97_15585) 3155355..3155624 - 270 WP_032439907.1 phage holin -
M5S97_RS15590 (M5S97_15590) 3156340..3156747 - 408 WP_017898984.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M5S97_RS15595 (M5S97_15595) 3156795..3156971 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
M5S97_RS15600 (M5S97_15600) 3157335..3159119 + 1785 WP_032415155.1 ATP-binding protein -
M5S97_RS15605 (M5S97_15605) 3159139..3160173 + 1035 WP_088296426.1 DNA cytosine methyltransferase -
M5S97_RS15610 (M5S97_15610) 3160198..3160539 - 342 WP_017898982.1 antiterminator Q family protein -
M5S97_RS15615 (M5S97_15615) 3160552..3161583 - 1032 WP_117077015.1 DUF968 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3127013..3218386 91373


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T255668 WP_012542177.1 NZ_CP103582:c3156971-3156795 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14959.96 Da        Isoelectric Point: 4.4277

>AT255668 WP_017898984.1 NZ_CP103582:c3156747-3156340 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A3Q9U6R4

References