Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 3156340..3156971 | Replicon | chromosome |
| Accession | NZ_CP103582 | ||
| Organism | Klebsiella pneumoniae strain 1498 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | M5S97_RS15595 | Protein ID | WP_012542177.1 |
| Coordinates | 3156795..3156971 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
| Locus tag | M5S97_RS15590 | Protein ID | WP_017898984.1 |
| Coordinates | 3156340..3156747 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S97_RS15560 (M5S97_15560) | 3152105..3152593 | - | 489 | WP_023342892.1 | DUF1441 family protein | - |
| M5S97_RS15565 (M5S97_15565) | 3152825..3153244 | - | 420 | WP_032422409.1 | hypothetical protein | - |
| M5S97_RS15570 (M5S97_15570) | 3153244..3153552 | - | 309 | WP_020315022.1 | hypothetical protein | - |
| M5S97_RS15575 (M5S97_15575) | 3154533..3154883 | - | 351 | WP_072122266.1 | hypothetical protein | - |
| M5S97_RS15580 (M5S97_15580) | 3154880..3155377 | - | 498 | WP_032439908.1 | lysozyme | - |
| M5S97_RS15585 (M5S97_15585) | 3155355..3155624 | - | 270 | WP_032439907.1 | phage holin | - |
| M5S97_RS15590 (M5S97_15590) | 3156340..3156747 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5S97_RS15595 (M5S97_15595) | 3156795..3156971 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5S97_RS15600 (M5S97_15600) | 3157335..3159119 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
| M5S97_RS15605 (M5S97_15605) | 3159139..3160173 | + | 1035 | WP_088296426.1 | DNA cytosine methyltransferase | - |
| M5S97_RS15610 (M5S97_15610) | 3160198..3160539 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
| M5S97_RS15615 (M5S97_15615) | 3160552..3161583 | - | 1032 | WP_117077015.1 | DUF968 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3127013..3218386 | 91373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T255668 WP_012542177.1 NZ_CP103582:c3156971-3156795 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT255668 WP_017898984.1 NZ_CP103582:c3156747-3156340 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q9U6R4 |