Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 734159..734934 | Replicon | chromosome |
Accession | NZ_CP103582 | ||
Organism | Klebsiella pneumoniae strain 1498 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | M5S97_RS03650 | Protein ID | WP_060568463.1 |
Coordinates | 734449..734934 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | M5S97_RS03645 | Protein ID | WP_004150912.1 |
Coordinates | 734159..734452 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S97_RS03625 (M5S97_03625) | 729367..729969 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
M5S97_RS03630 (M5S97_03630) | 730067..730978 | + | 912 | WP_023342207.1 | LysR family transcriptional regulator | - |
M5S97_RS03635 (M5S97_03635) | 730979..732127 | - | 1149 | WP_016947441.1 | PLP-dependent aspartate aminotransferase family protein | - |
M5S97_RS03640 (M5S97_03640) | 732138..733514 | - | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
M5S97_RS03645 (M5S97_03645) | 734159..734452 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
M5S97_RS03650 (M5S97_03650) | 734449..734934 | + | 486 | WP_060568463.1 | GNAT family N-acetyltransferase | Toxin |
M5S97_RS03655 (M5S97_03655) | 735647..736615 | - | 969 | WP_080465744.1 | IS5 family transposase | - |
M5S97_RS03665 (M5S97_03665) | 737203..737916 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 735647..736570 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17602.64 Da Isoelectric Point: 8.1629
>T255661 WP_060568463.1 NZ_CP103582:734449-734934 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRHNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRHNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|