Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4597902..4598712 | Replicon | chromosome |
| Accession | NZ_CP103579 | ||
| Organism | Klebsiella pneumoniae strain 4014 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | M5S61_RS22590 | Protein ID | WP_071081553.1 |
| Coordinates | 4597902..4598435 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | M5S61_RS22595 | Protein ID | WP_002887278.1 |
| Coordinates | 4598446..4598712 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S61_RS22585 (4596733) | 4596733..4597854 | + | 1122 | WP_016946712.1 | cupin domain-containing protein | - |
| M5S61_RS22590 (4597902) | 4597902..4598435 | - | 534 | WP_071081553.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| M5S61_RS22595 (4598446) | 4598446..4598712 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| M5S61_RS22600 (4598815) | 4598815..4600248 | - | 1434 | WP_032413318.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| M5S61_RS22605 (4600238) | 4600238..4600921 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
| M5S61_RS22610 (4601094) | 4601094..4602479 | + | 1386 | WP_032413315.1 | efflux transporter outer membrane subunit | - |
| M5S61_RS22615 (4602497) | 4602497..4602841 | + | 345 | WP_002887266.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19798.59 Da Isoelectric Point: 5.2614
>T255654 WP_071081553.1 NZ_CP103579:c4598435-4597902 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLATDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLATDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|