Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3997429..3998048 | Replicon | chromosome |
| Accession | NZ_CP103579 | ||
| Organism | Klebsiella pneumoniae strain 4014 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M5S61_RS19705 | Protein ID | WP_002892050.1 |
| Coordinates | 3997830..3998048 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M5S61_RS19700 | Protein ID | WP_002892066.1 |
| Coordinates | 3997429..3997803 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S61_RS19690 (3992581) | 3992581..3993774 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5S61_RS19695 (3993797) | 3993797..3996943 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5S61_RS19700 (3997429) | 3997429..3997803 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M5S61_RS19705 (3997830) | 3997830..3998048 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M5S61_RS19710 (3998207) | 3998207..3998773 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M5S61_RS19715 (3998745) | 3998745..3998885 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M5S61_RS19720 (3998906) | 3998906..3999376 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M5S61_RS19725 (3999351) | 3999351..4000802 | - | 1452 | WP_021313732.1 | PLP-dependent aminotransferase family protein | - |
| M5S61_RS19730 (4000903) | 4000903..4001601 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| M5S61_RS19735 (4001598) | 4001598..4001738 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M5S61_RS19740 (4001738) | 4001738..4002001 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255653 WP_002892050.1 NZ_CP103579:3997830-3998048 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT255653 WP_002892066.1 NZ_CP103579:3997429-3997803 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |