Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4344498..4345114 | Replicon | chromosome |
Accession | NZ_CP103577 | ||
Organism | Enterobacter hormaechei strain 4285 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5S64_RS21085 | Protein ID | WP_077266491.1 |
Coordinates | 4344498..4344869 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | M5S64_RS21090 | Protein ID | WP_015569912.1 |
Coordinates | 4344872..4345114 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S64_RS21070 (M5S64_21070) | 4341998..4342900 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
M5S64_RS21075 (M5S64_21075) | 4342897..4343532 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S64_RS21080 (M5S64_21080) | 4343529..4344458 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
M5S64_RS21085 (M5S64_21085) | 4344498..4344869 | - | 372 | WP_077266491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5S64_RS21090 (M5S64_21090) | 4344872..4345114 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M5S64_RS21095 (M5S64_21095) | 4345313..4346233 | + | 921 | WP_045340216.1 | alpha/beta hydrolase | - |
M5S64_RS21100 (M5S64_21100) | 4346242..4347183 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
M5S64_RS21105 (M5S64_21105) | 4347228..4347665 | - | 438 | WP_045340215.1 | D-aminoacyl-tRNA deacylase | - |
M5S64_RS21110 (M5S64_21110) | 4347662..4348543 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
M5S64_RS21115 (M5S64_21115) | 4348537..4349136 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
M5S64_RS21120 (M5S64_21120) | 4349255..4350055 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13723.85 Da Isoelectric Point: 6.4882
>T255644 WP_077266491.1 NZ_CP103577:c4344869-4344498 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|