Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4220802..4221406 | Replicon | chromosome |
| Accession | NZ_CP103577 | ||
| Organism | Enterobacter hormaechei strain 4285 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
| Locus tag | M5S64_RS20530 | Protein ID | WP_071788668.1 |
| Coordinates | 4221221..4221406 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5S64_RS20525 | Protein ID | WP_045339152.1 |
| Coordinates | 4220802..4221206 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S64_RS20510 (M5S64_20510) | 4216342..4217160 | - | 819 | WP_032649828.1 | helix-turn-helix domain-containing protein | - |
| M5S64_RS20515 (M5S64_20515) | 4217386..4218786 | + | 1401 | WP_017693791.1 | MFS transporter | - |
| M5S64_RS20520 (M5S64_20520) | 4218797..4220746 | + | 1950 | WP_045339155.1 | glycoside hydrolase family 127 protein | - |
| M5S64_RS20525 (M5S64_20525) | 4220802..4221206 | - | 405 | WP_045339152.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5S64_RS20530 (M5S64_20530) | 4221221..4221406 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5S64_RS20535 (M5S64_20535) | 4221656..4223194 | - | 1539 | WP_006808612.1 | aldehyde dehydrogenase AldB | - |
| M5S64_RS20540 (M5S64_20540) | 4223361..4224245 | + | 885 | WP_039269503.1 | ROK family protein | - |
| M5S64_RS20545 (M5S64_20545) | 4224249..4226087 | - | 1839 | WP_045339150.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T255643 WP_071788668.1 NZ_CP103577:c4221406-4221221 [Enterobacter hormaechei]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14947.72 Da Isoelectric Point: 4.2329
>AT255643 WP_045339152.1 NZ_CP103577:c4221206-4220802 [Enterobacter hormaechei]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHLEALFEMDEALPLPGNVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHLEALFEMDEALPLPGNVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|