Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3258321..3258941 | Replicon | chromosome |
| Accession | NZ_CP103577 | ||
| Organism | Enterobacter hormaechei strain 4285 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | M5S64_RS15895 | Protein ID | WP_015571250.1 |
| Coordinates | 3258723..3258941 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | M5S64_RS15890 | Protein ID | WP_006809850.1 |
| Coordinates | 3258321..3258695 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S64_RS15880 (M5S64_15880) | 3253448..3254641 | + | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5S64_RS15885 (M5S64_15885) | 3254664..3257810 | + | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5S64_RS15890 (M5S64_15890) | 3258321..3258695 | + | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| M5S64_RS15895 (M5S64_15895) | 3258723..3258941 | + | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| M5S64_RS15900 (M5S64_15900) | 3259150..3259701 | + | 552 | WP_045339381.1 | maltose O-acetyltransferase | - |
| M5S64_RS15905 (M5S64_15905) | 3259818..3260285 | + | 468 | WP_023296041.1 | YlaC family protein | - |
| M5S64_RS15910 (M5S64_15910) | 3260257..3261717 | - | 1461 | WP_045339383.1 | PLP-dependent aminotransferase family protein | - |
| M5S64_RS15915 (M5S64_15915) | 3261819..3262529 | + | 711 | WP_017383207.1 | GNAT family protein | - |
| M5S64_RS15920 (M5S64_15920) | 3262526..3262666 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| M5S64_RS15925 (M5S64_15925) | 3262669..3262929 | - | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T255642 WP_015571250.1 NZ_CP103577:3258723-3258941 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT255642 WP_006809850.1 NZ_CP103577:3258321-3258695 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |