Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3160971..3161497 | Replicon | chromosome |
| Accession | NZ_CP103577 | ||
| Organism | Enterobacter hormaechei strain 4285 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M5S64_RS15405 | Protein ID | WP_000323025.1 |
| Coordinates | 3160971..3161258 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M5S64_RS15410 | Protein ID | WP_000534858.1 |
| Coordinates | 3161258..3161497 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S64_RS15370 (M5S64_15370) | 3156541..3156717 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| M5S64_RS15375 (M5S64_15375) | 3157228..3158172 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| M5S64_RS15380 (M5S64_15380) | 3158268..3158870 | + | 603 | WP_012695474.1 | hypothetical protein | - |
| M5S64_RS15385 (M5S64_15385) | 3158930..3159280 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| M5S64_RS15390 (M5S64_15390) | 3159327..3159530 | + | 204 | WP_001015183.1 | hypothetical protein | - |
| M5S64_RS15395 (M5S64_15395) | 3159812..3160132 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| M5S64_RS15400 (M5S64_15400) | 3160745..3160870 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
| M5S64_RS15405 (M5S64_15405) | 3160971..3161258 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M5S64_RS15410 (M5S64_15410) | 3161258..3161497 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M5S64_RS15415 (M5S64_15415) | 3161522..3161626 | + | 105 | Protein_3018 | hypothetical protein | - |
| M5S64_RS15420 (M5S64_15420) | 3161760..3162683 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| M5S64_RS15425 (M5S64_15425) | 3162883..3163455 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| M5S64_RS15430 (M5S64_15430) | 3163931..3165169 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaSHV-12 / qnrA1 / sul1 / dfrA19 / aph(3'')-Ib / aph(6)-Id / mcr-9 / tet(D) | - | 3033858..3197438 | 163580 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T255641 WP_000323025.1 NZ_CP103577:c3161258-3160971 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|