Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2350514..2351253 | Replicon | chromosome |
| Accession | NZ_CP103577 | ||
| Organism | Enterobacter hormaechei strain 4285 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | M5S64_RS11140 | Protein ID | WP_045339804.1 |
| Coordinates | 2350768..2351253 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | M5S64_RS11135 | Protein ID | WP_003857131.1 |
| Coordinates | 2350514..2350780 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S64_RS11115 (M5S64_11115) | 2345990..2346976 | + | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
| M5S64_RS11120 (M5S64_11120) | 2346986..2347981 | + | 996 | WP_045339807.1 | DUF2891 domain-containing protein | - |
| M5S64_RS11125 (M5S64_11125) | 2348003..2349391 | - | 1389 | WP_045339805.1 | MFS transporter | - |
| M5S64_RS11130 (M5S64_11130) | 2349521..2350450 | + | 930 | WP_045339929.1 | LysR family transcriptional regulator | - |
| M5S64_RS11135 (M5S64_11135) | 2350514..2350780 | + | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| M5S64_RS11140 (M5S64_11140) | 2350768..2351253 | + | 486 | WP_045339804.1 | GNAT family N-acetyltransferase | Toxin |
| M5S64_RS11145 (M5S64_11145) | 2351304..2351873 | - | 570 | WP_032648331.1 | hypothetical protein | - |
| M5S64_RS11150 (M5S64_11150) | 2351889..2352854 | - | 966 | WP_032648329.1 | hypothetical protein | - |
| M5S64_RS11155 (M5S64_11155) | 2353123..2354526 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| M5S64_RS11160 (M5S64_11160) | 2354555..2355187 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| M5S64_RS11165 (M5S64_11165) | 2355262..2356230 | + | 969 | WP_022652343.1 | IS5-like element IS903B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17558.27 Da Isoelectric Point: 9.9658
>T255639 WP_045339804.1 NZ_CP103577:2350768-2351253 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAMMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAMMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|