Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 865660..866317 | Replicon | chromosome |
| Accession | NZ_CP103577 | ||
| Organism | Enterobacter hormaechei strain 4285 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | M5S64_RS04150 | Protein ID | WP_045340098.1 |
| Coordinates | 865907..866317 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | M5S64_RS04145 | Protein ID | WP_003863437.1 |
| Coordinates | 865660..865926 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S64_RS04125 (M5S64_04125) | 861066..862499 | - | 1434 | WP_023295383.1 | 6-phospho-beta-glucosidase BglA | - |
| M5S64_RS04130 (M5S64_04130) | 862616..863347 | - | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| M5S64_RS04135 (M5S64_04135) | 863614..864273 | + | 660 | WP_003863433.1 | hemolysin III family protein | - |
| M5S64_RS04140 (M5S64_04140) | 864385..865365 | - | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
| M5S64_RS04145 (M5S64_04145) | 865660..865926 | + | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| M5S64_RS04150 (M5S64_04150) | 865907..866317 | + | 411 | WP_045340098.1 | protein YgfX | Toxin |
| M5S64_RS04155 (M5S64_04155) | 866319..866840 | - | 522 | WP_015571793.1 | flavodoxin FldB | - |
| M5S64_RS04160 (M5S64_04160) | 866942..867838 | + | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| M5S64_RS04165 (M5S64_04165) | 867867..868580 | + | 714 | WP_006811871.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5S64_RS04170 (M5S64_04170) | 868586..870319 | + | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16249.14 Da Isoelectric Point: 11.7121
>T255632 WP_045340098.1 NZ_CP103577:865907-866317 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWGMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWGMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|