Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 299595..300191 | Replicon | chromosome |
| Accession | NZ_CP103577 | ||
| Organism | Enterobacter hormaechei strain 4285 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | M5S64_RS01435 | Protein ID | WP_023295756.1 |
| Coordinates | 299889..300191 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A927HL08 |
| Locus tag | M5S64_RS01430 | Protein ID | WP_023295755.1 |
| Coordinates | 299595..299882 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S64_RS01425 (M5S64_01425) | 297967..299598 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
| M5S64_RS01430 (M5S64_01430) | 299595..299882 | - | 288 | WP_023295755.1 | putative addiction module antidote protein | Antitoxin |
| M5S64_RS01435 (M5S64_01435) | 299889..300191 | - | 303 | WP_023295756.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5S64_RS01440 (M5S64_01440) | 300389..301261 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| M5S64_RS01445 (M5S64_01445) | 301262..301534 | - | 273 | WP_017382612.1 | DUF3811 domain-containing protein | - |
| M5S64_RS01450 (M5S64_01450) | 301585..302529 | - | 945 | WP_015570166.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| M5S64_RS01455 (M5S64_01455) | 302623..303972 | - | 1350 | WP_045340537.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11441.24 Da Isoelectric Point: 10.1042
>T255631 WP_023295756.1 NZ_CP103577:c300191-299889 [Enterobacter hormaechei]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|