Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4017637..4018469 | Replicon | chromosome |
| Accession | NZ_CP103570 | ||
| Organism | Escherichia coli strain 3045 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | M5S79_RS19300 | Protein ID | WP_000854765.1 |
| Coordinates | 4017637..4018011 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5S79_RS19305 | Protein ID | WP_001295723.1 |
| Coordinates | 4018101..4018469 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S79_RS19285 (4016701) | 4016701..4016850 | - | 150 | Protein_3769 | hypothetical protein | - |
| M5S79_RS19290 (4016956) | 4016956..4017132 | - | 177 | WP_000839290.1 | DUF957 domain-containing protein | - |
| M5S79_RS19295 (4017149) | 4017149..4017640 | - | 492 | WP_000976842.1 | DUF5983 family protein | - |
| M5S79_RS19300 (4017637) | 4017637..4018011 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| M5S79_RS19305 (4018101) | 4018101..4018469 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S79_RS19310 (4018632) | 4018632..4018853 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S79_RS19315 (4018916) | 4018916..4019392 | - | 477 | WP_001186774.1 | RadC family protein | - |
| M5S79_RS19320 (4019408) | 4019408..4019881 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| M5S79_RS19325 (4020223) | 4020223..4021041 | - | 819 | WP_046464190.1 | DUF932 domain-containing protein | - |
| M5S79_RS19330 (4021159) | 4021159..4021354 | - | 196 | Protein_3778 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4015443..4015820 | 377 | |
| - | inside | Prophage | - | fimE / fimB | 3997367..4093641 | 96274 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T255622 WP_000854765.1 NZ_CP103570:c4018011-4017637 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255622 WP_001295723.1 NZ_CP103570:c4018469-4018101 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|