Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2432691..2433329 | Replicon | chromosome |
Accession | NZ_CP103570 | ||
Organism | Escherichia coli strain 3045 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | M5S79_RS11730 | Protein ID | WP_001447010.1 |
Coordinates | 2433153..2433329 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5S79_RS11725 | Protein ID | WP_001270286.1 |
Coordinates | 2432691..2433107 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S79_RS11705 (2427843) | 2427843..2428784 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
M5S79_RS11710 (2428785) | 2428785..2429798 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M5S79_RS11715 (2429816) | 2429816..2430961 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
M5S79_RS11720 (2431206) | 2431206..2432612 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
M5S79_RS11725 (2432691) | 2432691..2433107 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5S79_RS11730 (2433153) | 2433153..2433329 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5S79_RS11735 (2433551) | 2433551..2433781 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M5S79_RS11740 (2433873) | 2433873..2435834 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5S79_RS11745 (2435907) | 2435907..2436443 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M5S79_RS11750 (2436535) | 2436535..2437710 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T255617 WP_001447010.1 NZ_CP103570:c2433329-2433153 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT255617 WP_001270286.1 NZ_CP103570:c2433107-2432691 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|