Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1806823..1807658 | Replicon | chromosome |
| Accession | NZ_CP103570 | ||
| Organism | Escherichia coli strain 3045 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X9TM58 |
| Locus tag | M5S79_RS08655 | Protein ID | WP_000854761.1 |
| Coordinates | 1806823..1807200 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5S79_RS08660 | Protein ID | WP_001295723.1 |
| Coordinates | 1807290..1807658 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S79_RS08615 (1802212) | 1802212..1802478 | - | 267 | WP_087757644.1 | EutP/PduV family microcompartment system protein | - |
| M5S79_RS08620 (1802848) | 1802848..1803219 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| M5S79_RS08625 (1803426) | 1803426..1803650 | - | 225 | Protein_1686 | transposase | - |
| M5S79_RS08630 (1803731) | 1803731..1804135 | + | 405 | WP_000839179.1 | transposase | - |
| M5S79_RS08635 (1804132) | 1804132..1804479 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5S79_RS08640 (1804528) | 1804528..1806067 | + | 1540 | Protein_1689 | IS66-like element ISEc22 family transposase | - |
| M5S79_RS08645 (1806498) | 1806498..1806578 | - | 81 | Protein_1690 | hypothetical protein | - |
| M5S79_RS08650 (1806678) | 1806678..1806826 | - | 149 | Protein_1691 | DUF5983 family protein | - |
| M5S79_RS08655 (1806823) | 1806823..1807200 | - | 378 | WP_000854761.1 | TA system toxin CbtA family protein | Toxin |
| M5S79_RS08660 (1807290) | 1807290..1807658 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S79_RS08665 (1807821) | 1807821..1808042 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S79_RS08670 (1808105) | 1808105..1808581 | - | 477 | WP_001186711.1 | RadC family protein | - |
| M5S79_RS08675 (1808596) | 1808596..1809069 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| M5S79_RS08680 (1809411) | 1809411..1810229 | - | 819 | WP_046464190.1 | DUF932 domain-containing protein | - |
| M5S79_RS08685 (1810347) | 1810347..1810542 | - | 196 | Protein_1698 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14205.25 Da Isoelectric Point: 7.3249
>T255611 WP_000854761.1 NZ_CP103570:c1807200-1806823 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255611 WP_001295723.1 NZ_CP103570:c1807658-1807290 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X9TM58 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |