Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1039796..1040379 | Replicon | chromosome |
| Accession | NZ_CP103570 | ||
| Organism | Escherichia coli strain 3045 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | M5S79_RS05030 | Protein ID | WP_000254738.1 |
| Coordinates | 1040044..1040379 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | M5S79_RS05025 | Protein ID | WP_000581937.1 |
| Coordinates | 1039796..1040044 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S79_RS05015 (1036135) | 1036135..1037436 | + | 1302 | WP_046464058.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| M5S79_RS05020 (1037484) | 1037484..1039718 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| M5S79_RS05025 (1039796) | 1039796..1040044 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| M5S79_RS05030 (1040044) | 1040044..1040379 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| M5S79_RS05035 (1040450) | 1040450..1041241 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| M5S79_RS05040 (1041469) | 1041469..1043106 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| M5S79_RS05045 (1043194) | 1043194..1044492 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| M5S79_RS05050 (1044548) | 1044548..1044910 | - | 363 | WP_000034928.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T255608 WP_000254738.1 NZ_CP103570:1040044-1040379 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|