Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5245503..5246128 | Replicon | chromosome |
| Accession | NZ_CP103567 | ||
| Organism | Klebsiella pneumoniae strain 4680 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | M5S58_RS25390 | Protein ID | WP_019705794.1 |
| Coordinates | 5245503..5245886 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M5S58_RS25395 | Protein ID | WP_004150355.1 |
| Coordinates | 5245886..5246128 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S58_RS25375 (5242869) | 5242869..5243771 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M5S58_RS25380 (5243768) | 5243768..5244403 | + | 636 | WP_032430299.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5S58_RS25385 (5244400) | 5244400..5245329 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| M5S58_RS25390 (5245503) | 5245503..5245886 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5S58_RS25395 (5245886) | 5245886..5246128 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M5S58_RS25400 (5246333) | 5246333..5247250 | + | 918 | WP_032430300.1 | alpha/beta hydrolase | - |
| M5S58_RS25405 (5247265) | 5247265..5248206 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| M5S58_RS25410 (5248251) | 5248251..5248688 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M5S58_RS25415 (5248685) | 5248685..5249545 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| M5S58_RS25420 (5249539) | 5249539..5250138 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T255605 WP_019705794.1 NZ_CP103567:c5245886-5245503 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |