Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4042503..4043122 | Replicon | chromosome |
| Accession | NZ_CP103567 | ||
| Organism | Klebsiella pneumoniae strain 4680 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M5S58_RS19655 | Protein ID | WP_002892050.1 |
| Coordinates | 4042904..4043122 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M5S58_RS19650 | Protein ID | WP_002892066.1 |
| Coordinates | 4042503..4042877 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S58_RS19640 (4037655) | 4037655..4038848 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5S58_RS19645 (4038871) | 4038871..4042017 | + | 3147 | WP_004147373.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5S58_RS19650 (4042503) | 4042503..4042877 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M5S58_RS19655 (4042904) | 4042904..4043122 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M5S58_RS19660 (4043281) | 4043281..4043847 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M5S58_RS19665 (4043819) | 4043819..4043959 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M5S58_RS19670 (4043980) | 4043980..4044450 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M5S58_RS19675 (4044425) | 4044425..4045876 | - | 1452 | WP_259384676.1 | PLP-dependent aminotransferase family protein | - |
| M5S58_RS19680 (4045977) | 4045977..4046675 | + | 699 | WP_040220001.1 | GNAT family protein | - |
| M5S58_RS19685 (4046672) | 4046672..4046812 | - | 141 | WP_040219999.1 | type B 50S ribosomal protein L36 | - |
| M5S58_RS19690 (4046812) | 4046812..4047075 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255601 WP_002892050.1 NZ_CP103567:4042904-4043122 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT255601 WP_002892066.1 NZ_CP103567:4042503-4042877 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |