Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4042503..4043122 Replicon chromosome
Accession NZ_CP103567
Organism Klebsiella pneumoniae strain 4680

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5S58_RS19655 Protein ID WP_002892050.1
Coordinates 4042904..4043122 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5S58_RS19650 Protein ID WP_002892066.1
Coordinates 4042503..4042877 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S58_RS19640 (4037655) 4037655..4038848 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5S58_RS19645 (4038871) 4038871..4042017 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit AcrB -
M5S58_RS19650 (4042503) 4042503..4042877 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5S58_RS19655 (4042904) 4042904..4043122 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5S58_RS19660 (4043281) 4043281..4043847 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5S58_RS19665 (4043819) 4043819..4043959 - 141 WP_004147370.1 hypothetical protein -
M5S58_RS19670 (4043980) 4043980..4044450 + 471 WP_002892026.1 YlaC family protein -
M5S58_RS19675 (4044425) 4044425..4045876 - 1452 WP_259384676.1 PLP-dependent aminotransferase family protein -
M5S58_RS19680 (4045977) 4045977..4046675 + 699 WP_040220001.1 GNAT family protein -
M5S58_RS19685 (4046672) 4046672..4046812 - 141 WP_040219999.1 type B 50S ribosomal protein L36 -
M5S58_RS19690 (4046812) 4046812..4047075 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255601 WP_002892050.1 NZ_CP103567:4042904-4043122 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255601 WP_002892066.1 NZ_CP103567:4042503-4042877 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References