Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 21354..21946 Replicon plasmid pMB8236_2
Accession NZ_CP103564
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag M5R24_RS27195 Protein ID WP_000520549.1
Coordinates 21354..21602 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag M5R24_RS27200 Protein ID WP_000681613.1
Coordinates 21599..21946 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS27150 (M5R24_27150) 16692..16943 + 252 WP_000121743.1 plasmid stabilization protein -
M5R24_RS27155 (M5R24_27155) 16933..17214 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin -
M5R24_RS27160 (M5R24_27160) 17238..17588 + 351 WP_000312755.1 hypothetical protein -
M5R24_RS27165 (M5R24_27165) 18228..18743 + 516 WP_001025397.1 J domain-containing protein -
M5R24_RS27170 (M5R24_27170) 18848..19390 + 543 WP_001083906.1 hypothetical protein -
M5R24_RS27175 (M5R24_27175) 19387..19638 + 252 WP_001230707.1 hypothetical protein -
M5R24_RS27180 (M5R24_27180) 19625..19852 + 228 WP_000801440.1 hypothetical protein -
M5R24_RS27185 (M5R24_27185) 20306..20605 + 300 WP_000650310.1 hypothetical protein -
M5R24_RS27190 (M5R24_27190) 20699..21049 + 351 WP_000854260.1 hypothetical protein -
M5R24_RS27195 (M5R24_27195) 21354..21602 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
M5R24_RS27200 (M5R24_27200) 21599..21946 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M5R24_RS27205 (M5R24_27205) 22310..22813 + 504 WP_000781817.1 DNA distortion polypeptide 1 -
M5R24_RS27210 (M5R24_27210) 22817..24046 + 1230 WP_259430640.1 DNA relaxase/nickase TaxC -
M5R24_RS27215 (M5R24_27215) 24123..24389 + 267 WP_000160396.1 hypothetical protein -
M5R24_RS27220 (M5R24_27220) 24394..24627 + 234 WP_000121161.1 EexN family lipoprotein -
M5R24_RS27225 (M5R24_27225) 24983..25603 + 621 WP_000157548.1 lytic transglycosylase domain-containing protein -
M5R24_RS27230 (M5R24_27230) 25617..25943 + 327 WP_000008647.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid fosA7 - 1..37348 37348


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T255591 WP_000520549.1 NZ_CP103564:21354-21602 [Escherichia coli O25b:H4-ST131]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT255591 WP_000681613.1 NZ_CP103564:21599-21946 [Escherichia coli O25b:H4-ST131]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References