Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 16692..17214 Replicon plasmid pMB8236_2
Accession NZ_CP103564
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag M5R24_RS27155 Protein ID WP_000220561.1
Coordinates 16933..17214 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M5R24_RS27150 Protein ID WP_000121743.1
Coordinates 16692..16943 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS27125 (M5R24_27125) 12024..12326 + 303 WP_001096506.1 hypothetical protein -
M5R24_RS27130 (M5R24_27130) 12363..12614 + 252 WP_000905714.1 hypothetical protein -
M5R24_RS27135 (M5R24_27135) 13186..13713 - 528 WP_000577047.1 DUF2726 domain-containing protein -
M5R24_RS27140 (M5R24_27140) 13849..14253 - 405 WP_000654312.1 hypothetical protein -
M5R24_RS27145 (M5R24_27145) 14319..15326 - 1008 WP_000243325.1 replication initiation protein -
M5R24_RS27150 (M5R24_27150) 16692..16943 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
M5R24_RS27155 (M5R24_27155) 16933..17214 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5R24_RS27160 (M5R24_27160) 17238..17588 + 351 WP_000312755.1 hypothetical protein -
M5R24_RS27165 (M5R24_27165) 18228..18743 + 516 WP_001025397.1 J domain-containing protein -
M5R24_RS27170 (M5R24_27170) 18848..19390 + 543 WP_001083906.1 hypothetical protein -
M5R24_RS27175 (M5R24_27175) 19387..19638 + 252 WP_001230707.1 hypothetical protein -
M5R24_RS27180 (M5R24_27180) 19625..19852 + 228 WP_000801440.1 hypothetical protein -
M5R24_RS27185 (M5R24_27185) 20306..20605 + 300 WP_000650310.1 hypothetical protein -
M5R24_RS27190 (M5R24_27190) 20699..21049 + 351 WP_000854260.1 hypothetical protein -
M5R24_RS27195 (M5R24_27195) 21354..21602 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
M5R24_RS27200 (M5R24_27200) 21599..21946 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid fosA7 - 1..37348 37348


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T255589 WP_000220561.1 NZ_CP103564:16933-17214 [Escherichia coli O25b:H4-ST131]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT255589 WP_000121743.1 NZ_CP103564:16692-16943 [Escherichia coli O25b:H4-ST131]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References