Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 232190..232791 Replicon plasmid pMB8236_1
Accession NZ_CP103563
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag M5R24_RS26980 Protein ID WP_191514958.1
Coordinates 232411..232791 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag M5R24_RS26975 Protein ID WP_259430634.1
Coordinates 232190..232411 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS26965 (229240) 229240..230454 - 1215 WP_025269841.1 restriction endonuclease subunit S -
M5R24_RS26970 (230451) 230451..232007 - 1557 WP_042065480.1 type I restriction-modification system subunit M -
M5R24_RS26975 (232190) 232190..232411 + 222 WP_259430634.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
M5R24_RS26980 (232411) 232411..232791 + 381 WP_191514958.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5R24_RS26985 (232796) 232796..232975 + 180 WP_001513661.1 hypothetical protein -
M5R24_RS26990 (233003) 233003..233281 + 279 Protein_277 pdcB -
M5R24_RS26995 (233286) 233286..233699 + 414 Protein_278 integrase core domain-containing protein -
M5R24_RS27000 (233649) 233649..233984 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
M5R24_RS27005 (234194) 234194..235174 - 981 WP_215198760.1 IS5-like element IS5 family transposase -
M5R24_RS27010 (235418) 235418..236821 + 1404 WP_191514960.1 S-methylmethionine permease -
M5R24_RS27015 (236808) 236808..237740 + 933 WP_259430635.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) / blaTEM-1B / mph(A) / sul1 / qacE / aadA2 / dfrA12 / sul2 senB / hlyD / hlyB / hlyA / hlyA / hlyC 1..241084 241084


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13645.34 Da        Isoelectric Point: 4.8838

>T255588 WP_191514958.1 NZ_CP103563:232411-232791 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYDGLPGMSDPGKAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8147.13 Da        Isoelectric Point: 4.7708

>AT255588 WP_259430634.1 NZ_CP103563:232190-232411 [Escherichia coli O25b:H4-ST131]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVTKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References