Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 221727..222252 Replicon plasmid pMB8236_1
Accession NZ_CP103563
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag M5R24_RS26935 Protein ID WP_001159871.1
Coordinates 221727..222032 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q0H051
Locus tag M5R24_RS26940 Protein ID WP_000813637.1
Coordinates 222034..222252 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS26905 (216803) 216803..217417 - 615 WP_000160640.1 TIR domain-containing protein -
M5R24_RS26910 (217586) 217586..218353 + 768 WP_001159649.1 DUF1883 domain-containing protein -
M5R24_RS26920 (219881) 219881..220510 + 630 WP_259430632.1 division plane positioning ATPase MipZ -
M5R24_RS26925 (220504) 220504..220779 + 276 WP_000239529.1 hypothetical protein -
M5R24_RS26930 (220917) 220917..221726 - 810 WP_000016979.1 site-specific integrase -
M5R24_RS26935 (221727) 221727..222032 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
M5R24_RS26940 (222034) 222034..222252 - 219 WP_000813637.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M5R24_RS26945 (222960) 222960..223955 + 996 WP_000246636.1 hypothetical protein -
M5R24_RS26950 (223959) 223959..224891 + 933 WP_058682609.1 S-4TM family putative pore-forming effector -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IIa / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / tet(A) / blaTEM-1B / mph(A) / sul1 / qacE / aadA2 / dfrA12 / sul2 senB / hlyD / hlyB / hlyA / hlyA / hlyC 1..241084 241084
- flank IS/Tn - - 225091..225468 377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T255587 WP_001159871.1 NZ_CP103563:c222032-221727 [Escherichia coli O25b:H4-ST131]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8428.45 Da        Isoelectric Point: 4.7405

>AT255587 WP_000813637.1 NZ_CP103563:c222252-222034 [Escherichia coli O25b:H4-ST131]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQEGMVEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB Q0H051

References