Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1986930..1987761 Replicon chromosome
Accession NZ_CP103562
Organism Escherichia coli O25b:H4-ST131 strain 751

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag M5R24_RS09510 Protein ID WP_000854815.1
Coordinates 1986930..1987304 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag M5R24_RS09515 Protein ID WP_001280918.1
Coordinates 1987393..1987761 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R24_RS09470 (1982326) 1982326..1983492 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M5R24_RS09475 (1983611) 1983611..1984084 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
M5R24_RS09480 (1984282) 1984282..1985340 + 1059 WP_001200889.1 FUSC family protein -
M5R24_RS09485 (1985512) 1985512..1985841 + 330 WP_000450409.1 DUF496 family protein -
M5R24_RS09490 (1985942) 1985942..1986265 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
M5R24_RS09495 (1986244) 1986244..1986324 + 81 WP_023441679.1 hypothetical protein -
M5R24_RS09500 (1986613) 1986613..1986693 - 81 Protein_1863 hypothetical protein -
M5R24_RS09505 (1986739) 1986739..1986933 - 195 WP_000988600.1 DUF5983 family protein -
M5R24_RS09510 (1986930) 1986930..1987304 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5R24_RS09515 (1987393) 1987393..1987761 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5R24_RS09520 (1987777) 1987777..1988421 - 645 WP_000086752.1 hypothetical protein -
M5R24_RS09525 (1988440) 1988440..1988661 - 222 WP_000692345.1 DUF987 domain-containing protein -
M5R24_RS09530 (1988724) 1988724..1989200 - 477 WP_001186200.1 RadC family protein -
M5R24_RS09535 (1989216) 1989216..1989689 - 474 WP_001542276.1 antirestriction protein -
M5R24_RS09540 (1989783) 1989783..1990028 - 246 WP_001164966.1 hypothetical protein -
M5R24_RS09545 (1990028) 1990028..1990846 - 819 WP_001542275.1 DUF932 domain-containing protein -
M5R24_RS09550 (1991067) 1991067..1991477 - 411 WP_000846703.1 hypothetical protein -
M5R24_RS09555 (1991493) 1991493..1991843 - 351 Protein_1874 hypothetical protein -
M5R24_RS09560 (1991926) 1991926..1992672 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T255563 WP_000854815.1 NZ_CP103562:c1987304-1986930 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT255563 WP_001280918.1 NZ_CP103562:c1987761-1987393 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References