Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 331625..332425 | Replicon | chromosome |
| Accession | NZ_CP103562 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 751 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4T503 |
| Locus tag | M5R24_RS01565 | Protein ID | WP_000342452.1 |
| Coordinates | 331898..332425 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4T504 |
| Locus tag | M5R24_RS01560 | Protein ID | WP_001277107.1 |
| Coordinates | 331625..331891 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R24_RS01540 (327284) | 327284..327952 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| M5R24_RS01545 (327945) | 327945..329003 | + | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
| M5R24_RS01550 (329248) | 329248..330102 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| M5R24_RS01555 (330373) | 330373..331476 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| M5R24_RS01560 (331625) | 331625..331891 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| M5R24_RS01565 (331898) | 331898..332425 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| M5R24_RS01570 (332422) | 332422..332805 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| M5R24_RS01575 (333228) | 333228..334337 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| M5R24_RS01580 (334385) | 334385..335311 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| M5R24_RS01585 (335308) | 335308..336585 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
| M5R24_RS01590 (336582) | 336582..337349 | + | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T255557 WP_000342452.1 NZ_CP103562:331898-332425 [Escherichia coli O25b:H4-ST131]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061K5K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061YQ57 |