Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4841162..4841678 | Replicon | chromosome |
Accession | NZ_CP103560 | ||
Organism | Klebsiella pneumoniae strain 5165 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M5R31_RS23535 | Protein ID | WP_004178374.1 |
Coordinates | 4841162..4841446 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | M5R31_RS23540 | Protein ID | WP_032434351.1 |
Coordinates | 4841436..4841678 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R31_RS23510 (4836645) | 4836645..4836908 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
M5R31_RS23515 (4837038) | 4837038..4837211 | + | 174 | WP_032414379.1 | hypothetical protein | - |
M5R31_RS23520 (4837214) | 4837214..4837957 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5R31_RS23525 (4838314) | 4838314..4840452 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5R31_RS23530 (4840694) | 4840694..4841158 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5R31_RS23535 (4841162) | 4841162..4841446 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5R31_RS23540 (4841436) | 4841436..4841678 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5R31_RS23545 (4841756) | 4841756..4843666 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M5R31_RS23550 (4843689) | 4843689..4844843 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M5R31_RS23555 (4844909) | 4844909..4845649 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255552 WP_004178374.1 NZ_CP103560:c4841446-4841162 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|