Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4748434..4749137 | Replicon | chromosome |
Accession | NZ_CP103560 | ||
Organism | Klebsiella pneumoniae strain 5165 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A939NMR5 |
Locus tag | M5R31_RS23140 | Protein ID | WP_071994632.1 |
Coordinates | 4748434..4748775 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
Locus tag | M5R31_RS23145 | Protein ID | WP_032434296.1 |
Coordinates | 4748796..4749137 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R31_RS23130 (4744749) | 4744749..4745618 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
M5R31_RS23135 (4746209) | 4746209..4748242 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
M5R31_RS23140 (4748434) | 4748434..4748775 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
M5R31_RS23145 (4748796) | 4748796..4749137 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5R31_RS23150 (4749148) | 4749148..4749690 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
M5R31_RS23155 (4749703) | 4749703..4750143 | - | 441 | WP_032434300.1 | antirestriction protein | - |
M5R31_RS23160 (4750174) | 4750174..4750995 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
M5R31_RS23165 (4751115) | 4751115..4751588 | - | 474 | WP_032434303.1 | hypothetical protein | - |
M5R31_RS23170 (4751660) | 4751660..4752112 | - | 453 | WP_032410767.1 | hypothetical protein | - |
M5R31_RS23175 (4752148) | 4752148..4752864 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
M5R31_RS23180 (4753108) | 4753108..4753982 | - | 875 | Protein_4541 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4736731..4782404 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T255551 WP_071994632.1 NZ_CP103560:c4748775-4748434 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|