Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4076081..4076700 Replicon chromosome
Accession NZ_CP103560
Organism Klebsiella pneumoniae strain 5165

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5R31_RS19925 Protein ID WP_002892050.1
Coordinates 4076482..4076700 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5R31_RS19920 Protein ID WP_002892066.1
Coordinates 4076081..4076455 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R31_RS19910 (4071233) 4071233..4072426 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5R31_RS19915 (4072449) 4072449..4075595 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5R31_RS19920 (4076081) 4076081..4076455 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5R31_RS19925 (4076482) 4076482..4076700 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5R31_RS19930 (4076859) 4076859..4077425 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5R31_RS19935 (4077397) 4077397..4077537 - 141 WP_004147370.1 hypothetical protein -
M5R31_RS19940 (4077558) 4077558..4078028 + 471 WP_002892026.1 YlaC family protein -
M5R31_RS19945 (4078003) 4078003..4079454 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
M5R31_RS19950 (4079555) 4079555..4080253 + 699 WP_032435564.1 GNAT family protein -
M5R31_RS19955 (4080250) 4080250..4080390 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5R31_RS19960 (4080390) 4080390..4080653 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255549 WP_002892050.1 NZ_CP103560:4076482-4076700 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255549 WP_002892066.1 NZ_CP103560:4076081-4076455 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References