Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3987438..3988056 | Replicon | chromosome |
Accession | NZ_CP103559 | ||
Organism | Escherichia coli strain 3059 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5T18_RS19540 | Protein ID | WP_001291435.1 |
Coordinates | 3987838..3988056 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M5T18_RS19535 | Protein ID | WP_000344800.1 |
Coordinates | 3987438..3987812 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T18_RS19525 (3982527) | 3982527..3983720 | + | 1194 | WP_259390505.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5T18_RS19530 (3983743) | 3983743..3986892 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
M5T18_RS19535 (3987438) | 3987438..3987812 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M5T18_RS19540 (3987838) | 3987838..3988056 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5T18_RS19545 (3988228) | 3988228..3988779 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
M5T18_RS19550 (3988895) | 3988895..3989365 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M5T18_RS19555 (3989529) | 3989529..3991079 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5T18_RS19560 (3991121) | 3991121..3991474 | - | 354 | WP_001550741.1 | DUF1428 family protein | - |
M5T18_RS19570 (3991853) | 3991853..3992164 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M5T18_RS19575 (3992195) | 3992195..3992767 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255533 WP_001291435.1 NZ_CP103559:3987838-3988056 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255533 WP_000344800.1 NZ_CP103559:3987438-3987812 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |