Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3584873..3585578 | Replicon | chromosome |
Accession | NZ_CP103559 | ||
Organism | Escherichia coli strain 3059 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M5T18_RS17765 | Protein ID | WP_000539521.1 |
Coordinates | 3584873..3585259 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5T18_RS17770 | Protein ID | WP_001280945.1 |
Coordinates | 3585249..3585578 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T18_RS17745 (3580877) | 3580877..3581503 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
M5T18_RS17750 (3581500) | 3581500..3582615 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
M5T18_RS17755 (3582726) | 3582726..3583109 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M5T18_RS17760 (3583322) | 3583322..3584647 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M5T18_RS17765 (3584873) | 3584873..3585259 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T18_RS17770 (3585249) | 3585249..3585578 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M5T18_RS17775 (3585648) | 3585648..3586976 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
M5T18_RS17780 (3586984) | 3586984..3589332 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
M5T18_RS17785 (3589510) | 3589510..3590421 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T255532 WP_000539521.1 NZ_CP103559:3584873-3585259 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|