Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3149499..3150283 | Replicon | chromosome |
| Accession | NZ_CP103559 | ||
| Organism | Escherichia coli strain 3059 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | V0T0H9 |
| Locus tag | M5T18_RS15630 | Protein ID | WP_000613626.1 |
| Coordinates | 3149789..3150283 (+) | Length | 165 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | L4JCW6 |
| Locus tag | M5T18_RS15625 | Protein ID | WP_001110447.1 |
| Coordinates | 3149499..3149792 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T18_RS15615 (3144649) | 3144649..3145608 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
| M5T18_RS15620 (3146181) | 3146181..3149366 | + | 3186 | WP_001550951.1 | ribonuclease E | - |
| M5T18_RS15625 (3149499) | 3149499..3149792 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
| M5T18_RS15630 (3149789) | 3149789..3150283 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
| M5T18_RS15635 (3150378) | 3150378..3151331 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
| M5T18_RS15640 (3151343) | 3151343..3152986 | - | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
| M5T18_RS15645 (3153052) | 3153052..3153993 | - | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
| M5T18_RS15650 (3153993) | 3153993..3155090 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T255529 WP_000613626.1 NZ_CP103559:3149789-3150283 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|