Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2543917..2544555 | Replicon | chromosome |
| Accession | NZ_CP103559 | ||
| Organism | Escherichia coli strain 3059 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | M5T18_RS12455 | Protein ID | WP_000813795.1 |
| Coordinates | 2543917..2544093 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5T18_RS12460 | Protein ID | WP_076797675.1 |
| Coordinates | 2544139..2544555 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T18_RS12435 (2539539) | 2539539..2540711 | - | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
| M5T18_RS12440 (2540803) | 2540803..2541339 | + | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| M5T18_RS12445 (2541412) | 2541412..2543373 | + | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5T18_RS12450 (2543465) | 2543465..2543695 | - | 231 | WP_023910283.1 | YncJ family protein | - |
| M5T18_RS12455 (2543917) | 2543917..2544093 | + | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5T18_RS12460 (2544139) | 2544139..2544555 | + | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5T18_RS12465 (2544634) | 2544634..2546040 | + | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| M5T18_RS12470 (2546285) | 2546285..2547430 | + | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
| M5T18_RS12475 (2547448) | 2547448..2548461 | + | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| M5T18_RS12480 (2548462) | 2548462..2549403 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T255523 WP_000813795.1 NZ_CP103559:2543917-2544093 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT255523 WP_076797675.1 NZ_CP103559:2544139-2544555 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|