Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 925949..926603 | Replicon | chromosome |
| Accession | NZ_CP103559 | ||
| Organism | Escherichia coli strain 3059 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | M5T18_RS04495 | Protein ID | WP_000244781.1 |
| Coordinates | 926196..926603 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M5T18_RS04490 | Protein ID | WP_000354046.1 |
| Coordinates | 925949..926215 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T18_RS04470 (922037) | 922037..923470 | - | 1434 | WP_001305827.1 | 6-phospho-beta-glucosidase BglA | - |
| M5T18_RS04475 (923515) | 923515..923826 | + | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5T18_RS04480 (923990) | 923990..924649 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M5T18_RS04485 (924726) | 924726..925706 | - | 981 | WP_135132679.1 | tRNA-modifying protein YgfZ | - |
| M5T18_RS04490 (925949) | 925949..926215 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M5T18_RS04495 (926196) | 926196..926603 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| M5T18_RS04500 (926643) | 926643..927164 | - | 522 | WP_001055888.1 | flavodoxin FldB | - |
| M5T18_RS04505 (927276) | 927276..928172 | + | 897 | WP_000806628.1 | site-specific tyrosine recombinase XerD | - |
| M5T18_RS04510 (928197) | 928197..928907 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T18_RS04515 (928913) | 928913..930646 | + | 1734 | WP_000813175.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T255512 WP_000244781.1 NZ_CP103559:926196-926603 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|