Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4798760..4799561 | Replicon | chromosome |
| Accession | NZ_CP103557 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4993 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | M5T49_RS24050 | Protein ID | WP_001094436.1 |
| Coordinates | 4799184..4799561 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | M5T49_RS24045 | Protein ID | WP_015953067.1 |
| Coordinates | 4798760..4799137 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T49_RS24010 (4794671) | 4794671..4795351 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| M5T49_RS24015 (4795499) | 4795499..4796176 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| M5T49_RS24020 (4796182) | 4796182..4796415 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| M5T49_RS24025 (4796505) | 4796505..4797323 | + | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
| M5T49_RS24030 (4797415) | 4797415..4797900 | + | 486 | WP_029700724.1 | antirestriction protein | - |
| M5T49_RS24035 (4797915) | 4797915..4798391 | + | 477 | WP_001186756.1 | RadC family protein | - |
| M5T49_RS24040 (4798460) | 4798460..4798681 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| M5T49_RS24045 (4798760) | 4798760..4799137 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| M5T49_RS24050 (4799184) | 4799184..4799561 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| M5T49_RS24055 (4799558) | 4799558..4800046 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| M5T49_RS24060 (4800058) | 4800058..4800255 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| M5T49_RS24065 (4800340) | 4800340..4801050 | + | 711 | WP_001621817.1 | DUF4942 domain-containing protein | - |
| M5T49_RS24070 (4801099) | 4801099..4801854 | - | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| M5T49_RS24075 (4801851) | 4801851..4803350 | - | 1500 | WP_029700729.1 | IS21-like element ISEc10 family transposase | - |
| M5T49_RS24080 (4803441) | 4803441..4803602 | + | 162 | Protein_4723 | DUF4942 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T255502 WP_001094436.1 NZ_CP103557:4799184-4799561 [Escherichia coli O25b:H4-ST131]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT255502 WP_015953067.1 NZ_CP103557:4798760-4799137 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |