Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4798760..4799561 Replicon chromosome
Accession NZ_CP103557
Organism Escherichia coli O25b:H4-ST131 strain 4993

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag M5T49_RS24050 Protein ID WP_001094436.1
Coordinates 4799184..4799561 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag M5T49_RS24045 Protein ID WP_015953067.1
Coordinates 4798760..4799137 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T49_RS24010 (4794671) 4794671..4795351 + 681 WP_001282919.1 WYL domain-containing protein -
M5T49_RS24015 (4795499) 4795499..4796176 + 678 WP_001097301.1 hypothetical protein -
M5T49_RS24020 (4796182) 4796182..4796415 + 234 WP_001278287.1 DUF905 family protein -
M5T49_RS24025 (4796505) 4796505..4797323 + 819 WP_001175163.1 DUF932 domain-containing protein -
M5T49_RS24030 (4797415) 4797415..4797900 + 486 WP_029700724.1 antirestriction protein -
M5T49_RS24035 (4797915) 4797915..4798391 + 477 WP_001186756.1 RadC family protein -
M5T49_RS24040 (4798460) 4798460..4798681 + 222 WP_000692312.1 DUF987 domain-containing protein -
M5T49_RS24045 (4798760) 4798760..4799137 + 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5T49_RS24050 (4799184) 4799184..4799561 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
M5T49_RS24055 (4799558) 4799558..4800046 + 489 WP_000761714.1 DUF5983 family protein -
M5T49_RS24060 (4800058) 4800058..4800255 + 198 WP_000839254.1 DUF957 domain-containing protein -
M5T49_RS24065 (4800340) 4800340..4801050 + 711 WP_001621817.1 DUF4942 domain-containing protein -
M5T49_RS24070 (4801099) 4801099..4801854 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
M5T49_RS24075 (4801851) 4801851..4803350 - 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
M5T49_RS24080 (4803441) 4803441..4803602 + 162 Protein_4723 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T255502 WP_001094436.1 NZ_CP103557:4799184-4799561 [Escherichia coli O25b:H4-ST131]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT255502 WP_015953067.1 NZ_CP103557:4798760-4799137 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References