Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4497481..4498316 | Replicon | chromosome |
| Accession | NZ_CP103557 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4993 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | M5T49_RS22520 | Protein ID | WP_000854759.1 |
| Coordinates | 4497481..4497858 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5T49_RS22525 | Protein ID | WP_001295723.1 |
| Coordinates | 4497948..4498316 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T49_RS22490 (4493419) | 4493419..4493595 | - | 177 | Protein_4410 | helix-turn-helix domain-containing protein | - |
| M5T49_RS22495 (4493787) | 4493787..4494533 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M5T49_RS22500 (4494548) | 4494548..4496089 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M5T49_RS22505 (4496548) | 4496548..4496697 | - | 150 | Protein_4413 | hypothetical protein | - |
| M5T49_RS22510 (4496803) | 4496803..4496979 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M5T49_RS22515 (4496996) | 4496996..4497484 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M5T49_RS22520 (4497481) | 4497481..4497858 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| M5T49_RS22525 (4497948) | 4497948..4498316 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T49_RS22530 (4498479) | 4498479..4498700 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5T49_RS22535 (4498763) | 4498763..4499239 | - | 477 | WP_001186775.1 | RadC family protein | - |
| M5T49_RS22540 (4499255) | 4499255..4499728 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| M5T49_RS22545 (4500070) | 4500070..4500888 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| M5T49_RS22550 (4501006) | 4501006..4501201 | - | 196 | Protein_4422 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T255500 WP_000854759.1 NZ_CP103557:c4497858-4497481 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255500 WP_001295723.1 NZ_CP103557:c4498316-4497948 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |