Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3853407..3854025 | Replicon | chromosome |
| Accession | NZ_CP103557 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4993 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5T49_RS19420 | Protein ID | WP_001291435.1 |
| Coordinates | 3853807..3854025 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5T49_RS19415 | Protein ID | WP_000344800.1 |
| Coordinates | 3853407..3853781 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T49_RS19405 (3848496) | 3848496..3849689 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5T49_RS19410 (3849712) | 3849712..3852861 | + | 3150 | WP_032154085.1 | efflux RND transporter permease AcrB | - |
| M5T49_RS19415 (3853407) | 3853407..3853781 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5T49_RS19420 (3853807) | 3853807..3854025 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5T49_RS19425 (3854199) | 3854199..3854750 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| M5T49_RS19430 (3854866) | 3854866..3855336 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M5T49_RS19435 (3855500) | 3855500..3857050 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5T49_RS19440 (3857092) | 3857092..3857445 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| M5T49_RS19450 (3857824) | 3857824..3858135 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| M5T49_RS19455 (3858166) | 3858166..3858738 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255496 WP_001291435.1 NZ_CP103557:3853807-3854025 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255496 WP_000344800.1 NZ_CP103557:3853407-3853781 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |