Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2029341..2030172 Replicon chromosome
Accession NZ_CP103557
Organism Escherichia coli O25b:H4-ST131 strain 4993

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag M5T49_RS09845 Protein ID WP_000854815.1
Coordinates 2029341..2029715 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag M5T49_RS09850 Protein ID WP_001280918.1
Coordinates 2029804..2030172 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T49_RS09805 (2024737) 2024737..2025903 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M5T49_RS09810 (2026022) 2026022..2026495 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
M5T49_RS09815 (2026693) 2026693..2027751 + 1059 WP_001200889.1 FUSC family protein -
M5T49_RS09820 (2027923) 2027923..2028252 + 330 WP_000450409.1 DUF496 family protein -
M5T49_RS09825 (2028353) 2028353..2028676 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
M5T49_RS09830 (2028655) 2028655..2028735 + 81 WP_023441679.1 hypothetical protein -
M5T49_RS09835 (2029024) 2029024..2029104 - 81 Protein_1927 hypothetical protein -
M5T49_RS09840 (2029150) 2029150..2029344 - 195 WP_000988600.1 DUF5983 family protein -
M5T49_RS09845 (2029341) 2029341..2029715 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5T49_RS09850 (2029804) 2029804..2030172 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T49_RS09855 (2030188) 2030188..2030832 - 645 WP_000086752.1 hypothetical protein -
M5T49_RS09860 (2030851) 2030851..2031072 - 222 WP_000692345.1 DUF987 domain-containing protein -
M5T49_RS09865 (2031135) 2031135..2031611 - 477 WP_001186200.1 RadC family protein -
M5T49_RS09870 (2031627) 2031627..2032100 - 474 WP_001542276.1 antirestriction protein -
M5T49_RS09875 (2032194) 2032194..2032439 - 246 WP_001164966.1 hypothetical protein -
M5T49_RS09880 (2032439) 2032439..2033257 - 819 WP_001542275.1 DUF932 domain-containing protein -
M5T49_RS09885 (2033478) 2033478..2033888 - 411 WP_000846703.1 hypothetical protein -
M5T49_RS09890 (2033904) 2033904..2034254 - 351 Protein_1938 hypothetical protein -
M5T49_RS09895 (2034337) 2034337..2035083 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T255489 WP_000854815.1 NZ_CP103557:c2029715-2029341 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT255489 WP_001280918.1 NZ_CP103557:c2030172-2029804 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References