Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 839505..840339 Replicon chromosome
Accession NZ_CP103557
Organism Escherichia coli O25b:H4-ST131 strain 4993

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag M5T49_RS04095 Protein ID WP_000854690.1
Coordinates 839505..839882 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag M5T49_RS04100 Protein ID WP_001305076.1
Coordinates 839971..840339 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T49_RS04065 (835899) 835899..836069 - 171 Protein_799 IS110 family transposase -
M5T49_RS04070 (836486) 836486..837419 - 934 Protein_800 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M5T49_RS04075 (837412) 837412..837807 - 396 WP_000208384.1 DUF6088 family protein -
M5T49_RS04080 (837876) 837876..838721 - 846 WP_001529401.1 DUF4942 domain-containing protein -
M5T49_RS04085 (838806) 838806..839003 - 198 WP_000839293.1 DUF957 domain-containing protein -
M5T49_RS04090 (839020) 839020..839508 - 489 WP_000761699.1 DUF5983 family protein -
M5T49_RS04095 (839505) 839505..839882 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
M5T49_RS04100 (839971) 839971..840339 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T49_RS04105 (840389) 840389..841033 - 645 WP_000094916.1 hypothetical protein -
M5T49_RS04110 (841052) 841052..841273 - 222 WP_000692329.1 DUF987 domain-containing protein -
M5T49_RS04115 (841336) 841336..841812 - 477 WP_001186726.1 RadC family protein -
M5T49_RS04120 (841828) 841828..842313 - 486 WP_000849565.1 antirestriction protein -
M5T49_RS04125 (842368) 842368..843186 - 819 WP_001234620.1 DUF932 domain-containing protein -
M5T49_RS04130 (843287) 843287..843520 - 234 WP_000902034.1 DUF905 family protein -
M5T49_RS04135 (843599) 843599..844054 - 456 WP_000581502.1 IrmA family protein -
M5T49_RS04140 (844130) 844130..845257 - 1128 Protein_814 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 817888..842313 24425


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T255486 WP_000854690.1 NZ_CP103557:c839882-839505 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT255486 WP_001305076.1 NZ_CP103557:c840339-839971 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References