Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 839505..840339 | Replicon | chromosome |
| Accession | NZ_CP103557 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4993 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | M5T49_RS04095 | Protein ID | WP_000854690.1 |
| Coordinates | 839505..839882 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | M5T49_RS04100 | Protein ID | WP_001305076.1 |
| Coordinates | 839971..840339 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T49_RS04065 (835899) | 835899..836069 | - | 171 | Protein_799 | IS110 family transposase | - |
| M5T49_RS04070 (836486) | 836486..837419 | - | 934 | Protein_800 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M5T49_RS04075 (837412) | 837412..837807 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| M5T49_RS04080 (837876) | 837876..838721 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| M5T49_RS04085 (838806) | 838806..839003 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| M5T49_RS04090 (839020) | 839020..839508 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| M5T49_RS04095 (839505) | 839505..839882 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| M5T49_RS04100 (839971) | 839971..840339 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T49_RS04105 (840389) | 840389..841033 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| M5T49_RS04110 (841052) | 841052..841273 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| M5T49_RS04115 (841336) | 841336..841812 | - | 477 | WP_001186726.1 | RadC family protein | - |
| M5T49_RS04120 (841828) | 841828..842313 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| M5T49_RS04125 (842368) | 842368..843186 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| M5T49_RS04130 (843287) | 843287..843520 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| M5T49_RS04135 (843599) | 843599..844054 | - | 456 | WP_000581502.1 | IrmA family protein | - |
| M5T49_RS04140 (844130) | 844130..845257 | - | 1128 | Protein_814 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF | 817888..842313 | 24425 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T255486 WP_000854690.1 NZ_CP103557:c839882-839505 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT255486 WP_001305076.1 NZ_CP103557:c840339-839971 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|