Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 690246..691081 | Replicon | chromosome |
Accession | NZ_CP103557 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 4993 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
Locus tag | M5T49_RS03385 | Protein ID | WP_000854722.1 |
Coordinates | 690704..691081 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0K4A940 |
Locus tag | M5T49_RS03380 | Protein ID | WP_001285576.1 |
Coordinates | 690246..690614 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T49_RS03360 (687971) | 687971..688789 | + | 819 | WP_021520251.1 | DUF932 domain-containing protein | - |
M5T49_RS03365 (688881) | 688881..689366 | + | 486 | WP_000206656.1 | antirestriction protein | - |
M5T49_RS03370 (689382) | 689382..689858 | + | 477 | WP_001360063.1 | RadC family protein | - |
M5T49_RS03375 (689945) | 689945..690166 | + | 222 | WP_000692176.1 | DUF987 domain-containing protein | - |
M5T49_RS03380 (690246) | 690246..690614 | + | 369 | WP_001285576.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T49_RS03385 (690704) | 690704..691081 | + | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
M5T49_RS03390 (691078) | 691078..691566 | + | 489 | WP_000761669.1 | DUF5983 family protein | - |
M5T49_RS03395 (691586) | 691586..691783 | + | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
M5T49_RS03400 (691868) | 691868..692713 | + | 846 | WP_001280427.1 | DUF4942 domain-containing protein | - |
M5T49_RS03410 (693013) | 693013..693519 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
M5T49_RS03415 (693597) | 693597..695438 | - | 1842 | WP_000437380.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T255485 WP_000854722.1 NZ_CP103557:690704-691081 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13599.36 Da Isoelectric Point: 6.3159
>AT255485 WP_001285576.1 NZ_CP103557:690246-690614 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J5ZPW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K4A940 |