Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11119..11762 | Replicon | plasmid pMB8590_1 |
| Accession | NZ_CP103555 | ||
| Organism | Klebsiella michiganensis strain 5088 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | M5R35_RS28025 | Protein ID | WP_016236302.1 |
| Coordinates | 11346..11762 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | M5R35_RS28020 | Protein ID | WP_001261282.1 |
| Coordinates | 11119..11349 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R35_RS27995 (M5R35_27995) | 6835..7092 | - | 258 | WP_023292103.1 | hypothetical protein | - |
| M5R35_RS28000 (M5R35_28000) | 7570..8298 | + | 729 | Protein_6 | CSS-motif domain-containing protein | - |
| M5R35_RS28005 (M5R35_28005) | 8314..9150 | + | 837 | WP_032439674.1 | EAL domain-containing protein | - |
| M5R35_RS28010 (M5R35_28010) | 9768..10199 | - | 432 | WP_174805835.1 | hypothetical protein | - |
| M5R35_RS28015 (M5R35_28015) | 10740..11162 | - | 423 | WP_046624301.1 | hypothetical protein | - |
| M5R35_RS28020 (M5R35_28020) | 11119..11349 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5R35_RS28025 (M5R35_28025) | 11346..11762 | + | 417 | WP_016236302.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5R35_RS28030 (M5R35_28030) | 11836..13398 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| M5R35_RS28035 (M5R35_28035) | 13383..14405 | + | 1023 | WP_032439672.1 | helicase UvrD | - |
| M5R35_RS28040 (M5R35_28040) | 14950..15858 | + | 909 | WP_032439686.1 | HNH endonuclease | - |
| M5R35_RS28045 (M5R35_28045) | 16044..16394 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / blaOXA-1 / aac(6')-Ib-cr / tet(A) / qnrB1 / aac(3)-IIa | - | 1..188758 | 188758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15091.55 Da Isoelectric Point: 7.1084
>T255481 WP_016236302.1 NZ_CP103555:11346-11762 [Klebsiella michiganensis]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|