Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5200859..5201435 | Replicon | chromosome |
| Accession | NZ_CP103554 | ||
| Organism | Klebsiella michiganensis strain 5088 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | M5R35_RS24520 | Protein ID | WP_071881753.1 |
| Coordinates | 5201148..5201435 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A0H3H591 |
| Locus tag | M5R35_RS24515 | Protein ID | WP_014227757.1 |
| Coordinates | 5200859..5201161 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R35_RS24500 (M5R35_24500) | 5197697..5198032 | + | 336 | WP_014227760.1 | endoribonuclease SymE | - |
| M5R35_RS24505 (M5R35_24505) | 5198486..5199397 | + | 912 | WP_014227759.1 | acetamidase/formamidase family protein | - |
| M5R35_RS24510 (M5R35_24510) | 5199394..5200737 | + | 1344 | WP_014227758.1 | APC family permease | - |
| M5R35_RS24515 (M5R35_24515) | 5200859..5201161 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
| M5R35_RS24520 (M5R35_24520) | 5201148..5201435 | - | 288 | WP_071881753.1 | BrnT family toxin | Toxin |
| M5R35_RS24525 (M5R35_24525) | 5201686..5202129 | - | 444 | WP_014227755.1 | FosA family fosfomycin resistance glutathione transferase | - |
| M5R35_RS24530 (M5R35_24530) | 5202123..5203031 | - | 909 | WP_014227754.1 | LysR family transcriptional regulator | - |
| M5R35_RS24535 (M5R35_24535) | 5203119..5203901 | + | 783 | WP_014227753.1 | NAD(P)H-dependent oxidoreductase | - |
| M5R35_RS24540 (M5R35_24540) | 5204049..5204633 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
| M5R35_RS24545 (M5R35_24545) | 5204779..5205579 | + | 801 | WP_014227752.1 | winged helix-turn-helix domain-containing protein | - |
| M5R35_RS24550 (M5R35_24550) | 5205576..5206094 | + | 519 | WP_004098240.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11239.69 Da Isoelectric Point: 8.5899
>T255479 WP_071881753.1 NZ_CP103554:c5201435-5201148 [Klebsiella michiganensis]
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|