Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4486026..4486645 Replicon chromosome
Accession NZ_CP103554
Organism Klebsiella michiganensis strain 5088

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag M5R35_RS21205 Protein ID WP_004099646.1
Coordinates 4486427..4486645 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag M5R35_RS21200 Protein ID WP_004129911.1
Coordinates 4486026..4486400 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R35_RS21190 (M5R35_21190) 4481183..4482376 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5R35_RS21195 (M5R35_21195) 4482399..4485545 + 3147 WP_014228207.1 multidrug efflux RND transporter permease subunit AcrB -
M5R35_RS21200 (M5R35_21200) 4486026..4486400 + 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
M5R35_RS21205 (M5R35_21205) 4486427..4486645 + 219 WP_004099646.1 HHA domain-containing protein Toxin
M5R35_RS21210 (M5R35_21210) 4486808..4487374 + 567 WP_038423299.1 maltose O-acetyltransferase -
M5R35_RS21215 (M5R35_21215) 4487346..4487480 - 135 WP_223226764.1 hypothetical protein -
M5R35_RS21220 (M5R35_21220) 4487501..4487971 + 471 WP_014228205.1 YlaC family protein -
M5R35_RS21225 (M5R35_21225) 4487946..4489400 - 1455 WP_014228204.1 PLP-dependent aminotransferase family protein -
M5R35_RS21230 (M5R35_21230) 4489502..4490200 + 699 WP_014228203.1 GNAT family protein -
M5R35_RS21235 (M5R35_21235) 4490197..4490337 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
M5R35_RS21240 (M5R35_21240) 4490337..4490600 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T255476 WP_004099646.1 NZ_CP103554:4486427-4486645 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT255476 WP_004129911.1 NZ_CP103554:4486026-4486400 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References