Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2082939..2083529 | Replicon | chromosome |
| Accession | NZ_CP103554 | ||
| Organism | Klebsiella michiganensis strain 5088 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A0H3HDW1 |
| Locus tag | M5R35_RS09895 | Protein ID | WP_014229979.1 |
| Coordinates | 2083197..2083529 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | J6I3K7 |
| Locus tag | M5R35_RS09890 | Protein ID | WP_004852307.1 |
| Coordinates | 2082939..2083196 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R35_RS09865 (M5R35_09865) | 2078195..2078800 | - | 606 | WP_032750440.1 | glutathione S-transferase family protein | - |
| M5R35_RS09870 (M5R35_09870) | 2078980..2079906 | + | 927 | WP_014229983.1 | LysR substrate-binding domain-containing protein | - |
| M5R35_RS09875 (M5R35_09875) | 2079944..2080942 | - | 999 | WP_014229982.1 | aldo/keto reductase | - |
| M5R35_RS09880 (M5R35_09880) | 2081043..2081957 | + | 915 | WP_014229981.1 | LysR family transcriptional regulator | - |
| M5R35_RS09885 (M5R35_09885) | 2082148..2082228 | - | 81 | Protein_1938 | molybdopterin-binding protein | - |
| M5R35_RS09890 (M5R35_09890) | 2082939..2083196 | + | 258 | WP_004852307.1 | antitoxin | Antitoxin |
| M5R35_RS09895 (M5R35_09895) | 2083197..2083529 | + | 333 | WP_014229979.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M5R35_RS09905 (M5R35_09905) | 2083852..2085309 | + | 1458 | WP_014229916.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| M5R35_RS09915 (M5R35_09915) | 2085672..2086162 | + | 491 | Protein_1942 | Arm DNA-binding domain-containing protein | - |
| M5R35_RS09920 (M5R35_09920) | 2086145..2086291 | - | 147 | Protein_1943 | DNA primase | - |
| M5R35_RS09925 (M5R35_09925) | 2086954..2088012 | + | 1059 | WP_014229913.1 | DNA cytosine methyltransferase | - |
| M5R35_RS09930 (M5R35_09930) | 2088025..2088207 | + | 183 | WP_228343140.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2082939..2094165 | 11226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11740.57 Da Isoelectric Point: 10.1863
>T255471 WP_014229979.1 NZ_CP103554:2083197-2083529 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HDW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HDW8 |