Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1309357..1310024 | Replicon | chromosome |
Accession | NZ_CP103554 | ||
Organism | Klebsiella michiganensis strain 5088 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | M5R35_RS06330 | Protein ID | WP_196588618.1 |
Coordinates | 1309357..1309686 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | M5R35_RS06335 | Protein ID | WP_165716179.1 |
Coordinates | 1309707..1310024 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R35_RS06310 (M5R35_06310) | 1305808..1305897 | - | 90 | Protein_1237 | MurR/RpiR family transcriptional regulator | - |
M5R35_RS06315 (M5R35_06315) | 1306489..1306575 | + | 87 | Protein_1238 | type VI secretion system contractile sheath small subunit | - |
M5R35_RS06320 (M5R35_06320) | 1306693..1308267 | + | 1575 | WP_014226460.1 | type VI secretion system protein TssA | - |
M5R35_RS06325 (M5R35_06325) | 1308369..1308848 | + | 480 | WP_014226459.1 | hypothetical protein | - |
M5R35_RS06330 (M5R35_06330) | 1309357..1309686 | - | 330 | WP_196588618.1 | TA system toxin CbtA family protein | Toxin |
M5R35_RS06335 (M5R35_06335) | 1309707..1310024 | - | 318 | WP_165716179.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5R35_RS06340 (M5R35_06340) | 1310043..1310264 | - | 222 | WP_165716178.1 | DUF987 domain-containing protein | - |
M5R35_RS06345 (M5R35_06345) | 1310273..1310755 | - | 483 | WP_165716177.1 | DNA repair protein RadC | - |
M5R35_RS06350 (M5R35_06350) | 1310764..1311222 | - | 459 | WP_196588619.1 | antirestriction protein | - |
M5R35_RS06355 (M5R35_06355) | 1311308..1311544 | - | 237 | Protein_1246 | DUF905 domain-containing protein | - |
M5R35_RS06360 (M5R35_06360) | 1311622..1312032 | - | 411 | WP_064791165.1 | hypothetical protein | - |
M5R35_RS06365 (M5R35_06365) | 1312099..1312536 | - | 438 | WP_023321463.1 | hypothetical protein | - |
M5R35_RS06370 (M5R35_06370) | 1312578..1313114 | - | 537 | WP_165716174.1 | DUF4339 domain-containing protein | - |
M5R35_RS06375 (M5R35_06375) | 1313140..1313850 | - | 711 | WP_047174770.1 | DeoR family transcriptional regulator | - |
M5R35_RS06380 (M5R35_06380) | 1314059..1314883 | - | 825 | WP_127785964.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12209.18 Da Isoelectric Point: 7.8584
>T255470 WP_196588618.1 NZ_CP103554:c1309686-1309357 [Klebsiella michiganensis]
MKNLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRKGF
SWQEQTPCLSVVDILRARRSTGLLKTNVK
MKNLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRKGF
SWQEQTPCLSVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|