Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 14588..15324 | Replicon | plasmid pMB8806_2 |
| Accession | NZ_CP103552 | ||
| Organism | Klebsiella pneumoniae strain 2791 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | M5T34_RS26840 | Protein ID | WP_003026803.1 |
| Coordinates | 14842..15324 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | M5T34_RS26835 | Protein ID | WP_003026799.1 |
| Coordinates | 14588..14854 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T34_RS26815 (M5T34_26815) | 10564..12264 | + | 1701 | WP_023292074.1 | AIPR family protein | - |
| M5T34_RS26820 (M5T34_26820) | 12450..13570 | + | 1121 | WP_087759376.1 | IS3 family transposase | - |
| M5T34_RS26825 (M5T34_26825) | 13662..13991 | + | 330 | WP_023292075.1 | hypothetical protein | - |
| M5T34_RS26830 (M5T34_26830) | 14187..14381 | - | 195 | WP_023292076.1 | hypothetical protein | - |
| M5T34_RS26835 (M5T34_26835) | 14588..14854 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| M5T34_RS26840 (M5T34_26840) | 14842..15324 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| M5T34_RS26845 (M5T34_26845) | 15536..16882 | + | 1347 | WP_020314316.1 | ISNCY family transposase | - |
| M5T34_RS26850 (M5T34_26850) | 17043..17174 | + | 132 | WP_004218042.1 | hypothetical protein | - |
| M5T34_RS26855 (M5T34_26855) | 17383..18548 | - | 1166 | Protein_20 | IS3 family transposase | - |
| M5T34_RS26860 (M5T34_26860) | 18725..19687 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| M5T34_RS26865 (M5T34_26865) | 19674..20162 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 12450..18410 | 5960 | |
| - | inside | Non-Mobilizable plasmid | aac(3)-IIa / dfrA14 | - | 1..55976 | 55976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T255466 WP_003026803.1 NZ_CP103552:14842-15324 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |