Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 5809..6334 | Replicon | plasmid pMB8806_2 |
Accession | NZ_CP103552 | ||
Organism | Klebsiella pneumoniae strain 2791 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | W8UQV6 |
Locus tag | M5T34_RS26790 | Protein ID | WP_001568026.1 |
Coordinates | 5809..6114 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | M5T34_RS26795 | Protein ID | WP_001568025.1 |
Coordinates | 6116..6334 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T34_RS26760 (M5T34_26760) | 1501..2127 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
M5T34_RS26765 (M5T34_26765) | 2124..2426 | + | 303 | WP_004197636.1 | hypothetical protein | - |
M5T34_RS26770 (M5T34_26770) | 2890..3684 | - | 795 | WP_004197635.1 | site-specific integrase | - |
M5T34_RS26775 (M5T34_26775) | 3882..4898 | - | 1017 | WP_020315256.1 | hypothetical protein | - |
M5T34_RS26780 (M5T34_26780) | 4895..5218 | - | 324 | WP_022644730.1 | hypothetical protein | - |
M5T34_RS26785 (M5T34_26785) | 5245..5640 | - | 396 | WP_017899885.1 | hypothetical protein | - |
M5T34_RS26790 (M5T34_26790) | 5809..6114 | - | 306 | WP_001568026.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M5T34_RS26795 (M5T34_26795) | 6116..6334 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M5T34_RS26800 (M5T34_26800) | 7167..7619 | + | 453 | WP_004201034.1 | hypothetical protein | - |
M5T34_RS26805 (M5T34_26805) | 8136..8756 | + | 621 | WP_023292072.1 | DNA-binding protein | - |
M5T34_RS26810 (M5T34_26810) | 8753..9817 | + | 1065 | WP_023292073.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(3)-IIa / dfrA14 | - | 1..55976 | 55976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11645.32 Da Isoelectric Point: 5.6919
>T255465 WP_001568026.1 NZ_CP103552:c6114-5809 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASAWLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASAWLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EZN1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |