Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4913806..4914509 | Replicon | chromosome |
| Accession | NZ_CP103550 | ||
| Organism | Klebsiella pneumoniae strain 2791 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | M5T34_RS24000 | Protein ID | WP_071994632.1 |
| Coordinates | 4914168..4914509 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | M5T34_RS23995 | Protein ID | WP_032434296.1 |
| Coordinates | 4913806..4914147 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T34_RS23960 (4908961) | 4908961..4909835 | + | 875 | Protein_4694 | GTPase family protein | - |
| M5T34_RS23965 (4910079) | 4910079..4910795 | + | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| M5T34_RS23970 (4910831) | 4910831..4911283 | + | 453 | WP_032410767.1 | hypothetical protein | - |
| M5T34_RS23975 (4911355) | 4911355..4911828 | + | 474 | WP_032434303.1 | hypothetical protein | - |
| M5T34_RS23980 (4911948) | 4911948..4912769 | + | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| M5T34_RS23985 (4912800) | 4912800..4913240 | + | 441 | WP_032434300.1 | antirestriction protein | - |
| M5T34_RS23990 (4913253) | 4913253..4913795 | + | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| M5T34_RS23995 (4913806) | 4913806..4914147 | + | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T34_RS24000 (4914168) | 4914168..4914509 | + | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| M5T34_RS24005 (4914701) | 4914701..4916734 | - | 2034 | WP_050598589.1 | hypothetical protein | - |
| M5T34_RS24010 (4917325) | 4917325..4918194 | - | 870 | WP_023317468.1 | HNH endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCTX-M-15 | - | 4878236..4928221 | 49985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T255461 WP_071994632.1 NZ_CP103550:4914168-4914509 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|