Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4818289..4818805 | Replicon | chromosome |
| Accession | NZ_CP103550 | ||
| Organism | Klebsiella pneumoniae strain 2791 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M5T34_RS23595 | Protein ID | WP_004178374.1 |
| Coordinates | 4818521..4818805 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | M5T34_RS23590 | Protein ID | WP_032434351.1 |
| Coordinates | 4818289..4818531 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T34_RS23575 (4814318) | 4814318..4815058 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| M5T34_RS23580 (4815124) | 4815124..4816278 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
| M5T34_RS23585 (4816301) | 4816301..4818211 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M5T34_RS23590 (4818289) | 4818289..4818531 | + | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5T34_RS23595 (4818521) | 4818521..4818805 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T34_RS23600 (4818809) | 4818809..4819273 | - | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5T34_RS23605 (4819515) | 4819515..4821653 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5T34_RS23610 (4822010) | 4822010..4822753 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5T34_RS23615 (4822756) | 4822756..4822929 | - | 174 | WP_032414379.1 | hypothetical protein | - |
| M5T34_RS23620 (4823014) | 4823014..4823322 | + | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255460 WP_004178374.1 NZ_CP103550:4818521-4818805 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|