Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 5292192..5292811 Replicon chromosome
Accession NZ_CP103548
Organism Klebsiella pneumoniae strain 3987

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5T27_RS25700 Protein ID WP_002892050.1
Coordinates 5292192..5292410 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5T27_RS25705 Protein ID WP_002892066.1
Coordinates 5292437..5292811 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T27_RS25665 (5288239) 5288239..5288502 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
M5T27_RS25670 (5288502) 5288502..5288642 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5T27_RS25675 (5288639) 5288639..5289337 - 699 WP_032435564.1 GNAT family protein -
M5T27_RS25680 (5289438) 5289438..5290889 + 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
M5T27_RS25685 (5290864) 5290864..5291334 - 471 WP_002892026.1 YlaC family protein -
M5T27_RS25690 (5291355) 5291355..5291495 + 141 WP_004147370.1 hypothetical protein -
M5T27_RS25695 (5291467) 5291467..5292033 - 567 WP_002892030.1 maltose O-acetyltransferase -
M5T27_RS25700 (5292192) 5292192..5292410 - 219 WP_002892050.1 HHA domain-containing protein Toxin
M5T27_RS25705 (5292437) 5292437..5292811 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5T27_RS25710 (5293297) 5293297..5296443 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5T27_RS25715 (5296466) 5296466..5297659 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255449 WP_002892050.1 NZ_CP103548:c5292410-5292192 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255449 WP_002892066.1 NZ_CP103548:c5292811-5292437 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References