Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 5292192..5292811 | Replicon | chromosome |
| Accession | NZ_CP103548 | ||
| Organism | Klebsiella pneumoniae strain 3987 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M5T27_RS25700 | Protein ID | WP_002892050.1 |
| Coordinates | 5292192..5292410 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M5T27_RS25705 | Protein ID | WP_002892066.1 |
| Coordinates | 5292437..5292811 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T27_RS25665 (5288239) | 5288239..5288502 | + | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
| M5T27_RS25670 (5288502) | 5288502..5288642 | + | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M5T27_RS25675 (5288639) | 5288639..5289337 | - | 699 | WP_032435564.1 | GNAT family protein | - |
| M5T27_RS25680 (5289438) | 5289438..5290889 | + | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
| M5T27_RS25685 (5290864) | 5290864..5291334 | - | 471 | WP_002892026.1 | YlaC family protein | - |
| M5T27_RS25690 (5291355) | 5291355..5291495 | + | 141 | WP_004147370.1 | hypothetical protein | - |
| M5T27_RS25695 (5291467) | 5291467..5292033 | - | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M5T27_RS25700 (5292192) | 5292192..5292410 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M5T27_RS25705 (5292437) | 5292437..5292811 | - | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M5T27_RS25710 (5293297) | 5293297..5296443 | - | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5T27_RS25715 (5296466) | 5296466..5297659 | - | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255449 WP_002892050.1 NZ_CP103548:c5292410-5292192 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT255449 WP_002892066.1 NZ_CP103548:c5292811-5292437 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |